Croote, D., Quake, S.R. Food allergen detection by mass spectrometry: the role of systems biology. npj Syst Biol Appl. 2016 Sep 29; 2:16022.
Megrim whiff gallo Protein: Lep w 1 | β-Parvalbumin
Empirical Proteotypic Peptide Explorer:
This rose plot enables visualization of proteotypic peptides. Each colored rose petal corresponds to a peptide and is bounded by thin gray petals, which represent tryptic cut sites. The radial magnitude of each peptide corresponds to the number of publications which report it.
Hover over a rose petal with your mouse to see the peptide. Click on a rose petal to see the species specificity of that peptide and add it to your cart.
Sequence - 109 amino acids
MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEEDELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK
UniProt: B5WX08 IUIS: Lep w 1Peptide Selector Tool
Explore peptide targets for mass spectrometry by adjusting the selection criteria below. Results from empirical and computational prediction tools have been aggregated for convenience.
Minimum length:
Maximum length:
| 1 | Peptide | 2 | Exp.3 | ESP4 | CONSeQ5 |
|---|---|---|---|---|---|
| ^ | MTFAGLDAAEIK | A | 0 | 0.468 | 0.71338 |
| K | AALDGCAAADSFDYK | K | 0 | 0.606 | 0.59462 |
| K | FFGACGLAK | K | 0 | 0.418 | 0.42594 |
| K | IDQDESGFIEEDELK | L | 0 | 0.581 | 0.56828 |
| K | LFLQNFSASAR | A | 0 | 0.614 | 0.42758 |
| K | ETANFLK | A | 0 | 0.237 | 0.28466 |
| K | AGDVDGDGK | I | 0 | 0.266 | 0.1924 |
| K | IGIEEFTDLVR | S | 0 | 0.564 | 0.41274 |
1 Previous amino acid (^ = Start of protein)
2 Next amino acid ($ = End of protein)
3 Exp. = Number of publications in which this peptide has been reported experimentally
4 ESP = ESP Predictor. Fusaro VA, et al. Nat Botechnol 2009; 27(2): 190-198. doi
5 CONSeQ = CONSeQuence. Eyers CE, et al. Mol Cell Proteomics 2011; 10(11). doi
Underline: Peptide occurs within the first 20 amino acids from the start of the protein. Use caution as the protein may contain a cleaved signaling sequence.
Strike-through: Peptide is present in a protein from another allergen species and is thus nonspecific.